PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_69407g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 373aa    MW: 42149.6 Da    PI: 8.1649
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_69407g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-1460107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT+ Ed +l ++++ +G g W+  +++ g++R++k+c++rw +yl
    MA_69407g0010  60 RGAWTEKEDMILSEYIRIHGDGKWRYLPEKAGLKRCGKSCRLRWVNYL 107
                      89********************************************97 PP

2Myb_DNA-binding44.53.6e-14113157147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++ E+el+++++++lG++ W++Ia +++ gRt+ ++k++w+ +
    MA_69407g0010 113 RGNISPYEEELIIRLHRLLGNR-WSLIAGRLP-GRTDSEIKNYWNCH 157
                      7888999***************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-2151110IPR009057Homeodomain-like
PROSITE profilePS5129414.54255107IPR017930Myb domain
SuperFamilySSF466895.86E-2757154IPR009057Homeodomain-like
SMARTSM007171.7E-1059109IPR001005SANT/Myb domain
PfamPF002491.6E-1260107IPR001005SANT/Myb domain
CDDcd001674.56E-862107No hitNo description
PROSITE profilePS5129422.739108162IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-22111162IPR009057Homeodomain-like
SMARTSM007172.0E-13112160IPR001005SANT/Myb domain
PfamPF002493.6E-12113155IPR001005SANT/Myb domain
CDDcd001674.75E-10120158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MTGSPARTLA VLTLLHGMSL AGQHPEAQSR SSAAELAITD YIRRSNMGRS PCCSKQGLNR  60
GAWTEKEDMI LSEYIRIHGD GKWRYLPEKA GLKRCGKSCR LRWVNYLHPD IKRGNISPYE  120
EELIIRLHRL LGNRWSLIAG RLPGRTDSEI KNYWNCHLGK KLLSMNQSKL KSSKHNLNRR  180
SKDPPPRQNY VYRATPVRIS TAVRQSELVK LNSGSEIRSA DHAFKLSNIK ETMNCSQSSC  240
HLLVNNDSEH MAFGMADVNL VKTEGTNSPC SMWNLADQKL PHSDHFAEHA ATLDGSLFDL  300
KEISSSQSDF LTDFGLEDFY SGPARLSTET NEIEYVWSEQ SNMQNVNSLT FAGEQGIQEC  360
YDSTHPLLEY ILN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-22581625108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1167521e-111BT116752.1 Picea glauca clone GQ03806_A01 mRNA sequence.
GenBankKU1312191e-111KU131219.1 Picea abies transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LMJ61e-115B8LMJ6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-51myb domain protein 3